PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G42800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 492aa    MW: 54783.8 Da    PI: 4.4813
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G42800.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4319.4e-1321234922374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL++cA a+s+ +  +aqa+++ l++++s +gdp qR+aay++e+Laar++ s++++ykal+++e +   +  +l+a+++++e++P+++f++
  ORUFI01G42800.1 123 KQLLFDCAMALSDYNVDEAQAIITDLRQMVSIQGDPSQRIAAYLVEGLAARIVASGKGIYKALSCKEPP---TLYQLSAMQILFEICPCFRFGF 213
                      589*****************************************************************9...89999***************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      ++aN aIlea +ge+rvHiiDfdi+qG Q+++L+q L + +++p +lRiTgv++pe++      l+ +g+rL+k+Ae +g++fef++ v  ++ 
  ORUFI01G42800.1 214 MAANYAILEACKGEDRVHIIDFDINQGSQYITLIQFLKNNANKPRHLRITGVDDPETVqrTVGGLKVIGQRLEKLAEDCGISFEFRA-VGANIG 306
                      ********************************************************99778889***********************.799*** PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                      d+++ +L+++pgEal+Vn+++qlh+l+desvs+ +erd++L++vk+l+Pk+v++veq+a++n+++F +rf e  +yy+alfdsl+a+lpres +
  ORUFI01G42800.1 307 DVTPAMLDCRPGEALVVNFAFQLHHLPDESVSIMNERDQLLRMVKGLQPKLVTLVEQDANTNTAPFQTRFREVYDYYAALFDSLDATLPRESPD 400
                      ********************************************************************************************** PP

             GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      r++vEr++l+reivn++aceg +r+er e ++kWr+r+++aGF+p p+s+++ + +++ll+ + ++ y+ ee++g l +gW +++L++ SaW+
  ORUFI01G42800.1 401 RMNVERQCLAREIVNILACEGPDRVERYEVAGKWRARMTMAGFTPCPFSSNVISGIRSLLKSYCDR-YKFEEDHGGLHFGWGEKTLIVSSAWQ 492
                      ****************************************************************66.*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.43496473IPR005202Transcription factor GRAS
PfamPF035143.2E-129123492IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MPYMVTADGH SPSSADNSCS DVAKDSPLVS NVSQQNSQSI SDNQSSELEV EFDEDDIRMK  60
LQELEHALLD DSDDILYEIS QAGSINDEWA DPMKNVILPN SPKESESSIS CAGSNNGEPR  120
TPKQLLFDCA MALSDYNVDE AQAIITDLRQ MVSIQGDPSQ RIAAYLVEGL AARIVASGKG  180
IYKALSCKEP PTLYQLSAMQ ILFEICPCFR FGFMAANYAI LEACKGEDRV HIIDFDINQG  240
SQYITLIQFL KNNANKPRHL RITGVDDPET VQRTVGGLKV IGQRLEKLAE DCGISFEFRA  300
VGANIGDVTP AMLDCRPGEA LVVNFAFQLH HLPDESVSIM NERDQLLRMV KGLQPKLVTL  360
VEQDANTNTA PFQTRFREVY DYYAALFDSL DATLPRESPD RMNVERQCLA REIVNILACE  420
GPDRVERYEV AGKWRARMTM AGFTPCPFSS NVISGIRSLL KSYCDRYKFE EDHGGLHFGW  480
GEKTLIVSSA WQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-561244926375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0608330.0AK060833.1 Oryza sativa Japonica Group cDNA clone:001-034-C07, full insert sequence.
GenBankAK0674570.0AK067457.1 Oryza sativa Japonica Group cDNA clone:J013106L10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610828.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A0E0N5V50.0A0A0E0N5V5_ORYRU; Uncharacterized protein
STRINGORGLA01G0333300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51753860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1